DAAM2 (Disheveled-associated Activator Of Morphogenesis 2, KIAA0381), 125617-100ug
- Store at -20°c. Recommended dilution optimal dilutions to be determined by the researcher. Aa sequence maprkrshhglgflccfggsdipeinlrdnhplqfmefsspipnaeelnirfaelvdeldltdknreamfalppekkwqiycskkkvpsltplatsqgswhgvalaalacscihlmfitcqpcsrcwrnnse storage and stability may be stored at 4°c for short-term only. Other applications not tested. It contains one of each dad (diaphanous autoregulatory), fh1 (formin homology 1), fh2 (formin homology 2) and gbd/fh3 (rho gtpase-binding/formin homology 3) domain. Applications suitable for use in western blot. Daam2 is a 1068aa protein belonging to the formin homology family. Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. It plays a role in rho gtpase binding and is expressed mostly in spinal cord and nerve tissues. Its main function is actin cytoskeleton organization, thus leading to cell organization and biogenesis. Aliquots are stable for at least 12 months.
DAAM1-T361, NT (DAAM1, KIAA0666, Disheveled-associated activator of morphogenesis 1), 034453-200ul
- Applications suitable for use in western blot, immunohistochemistry, flow cytometry, elisa recommended dilution elisa 11,000 western blot 1100-500 immunohistochemistry 150-100 flow cytometry 110-50 storage and stability may be stored at 4°c for short-term only. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Store at -20°c. Wnt/fz signaling activates the small gtpase rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Activation requires dvl-rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein. Evidence of alternative splicing has been observed for this gene but the full-length nature of these variants has not been determined. Aliquot to avoid repeated freezing and thawing. The protein encoded by this gene contains fh domains and belongs to a novel fh protein subfamily implicated in cell polarity. Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the formin homology (fh) proteins in these processes. Aliquots are stable for 12 months.
ANTXR2 (Anthrax Toxin Receptor 2, Capillary Morphogenesis Gene 2 Protein, CMG-2, CMG2), C1077-45C-100ug
- Storage and stability may be stored at 4°c for short-term only. Store at -20°c. Applications suitable for use in elisa and western blot. Recommended dilution elisa 116,000 western blot 0. Aliquots are stable for at least 12 months. Other applications not tested. Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. 3-1ug/ml, human, mouse and rat kidney lysates observed on ~60kd bands optimal dilutions to be determined by the researcher. Necessary for cellular interactions with laminin and the extracellular matrix.
DAAM1-T361, NT (DAAM1, KIAA0666, Disheveled-associated activator of morphogenesis 1) (APC), 034453-APC-200ul
- The protein encoded by this gene contains fh domains and belongs to a novel fh protein subfamily implicated in cell polarity. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Evidence of alternative splicing has been observed for this gene but the full-length nature of these variants has not been determined. Note applications are based on unconjugated antibody. Wnt/fz signaling activates the small gtpase rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Do not freeze stable at 4°c for 12 months after receipt as an undiluted liquid. Activation requires dvl-rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein. Caution apc conjugates are sensitive to light. Applications suitable for use in western blot, immunohistochemistry, flow cytometry, flisa recommended dilution flisa 11,000 western blot 1100-500 immunohistochemistry 150-100 flow cytometry 110-50 storage and stability store product at 4°c in the dark. Dilute required amount only prior to immediate use. Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the formin homology (fh) proteins in these processes. Further dilutions can be made in assay buffer.
DAAM1-T361, NT (DAAM1, KIAA0666, Disheveled-associated activator of morphogenesis 1) (AP), 034453-AP-200ul
- Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the formin homology (fh) proteins in these processes. Applications suitable for use in western blot, immunohistochemistry, flow cytometry, elisa recommended dilution elisa 11,000 western blot 1100-500 immunohistochemistry 150-100 flow cytometry 110-50 storage and stability store product at 4°c. Activation requires dvl-rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein. Evidence of alternative splicing has been observed for this gene but the full-length nature of these variants has not been determined. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer. Note applications are based on unconjugated antibody. Do not freeze stable at 4°c for 12 months after receipt as an undiluted liquid. The protein encoded by this gene contains fh domains and belongs to a novel fh protein subfamily implicated in cell polarity. Wnt/fz signaling activates the small gtpase rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Dilute required amount only prior to immediate use.
DAAM1, NT (Disheveled-associated Activator Of Morphogenesis 1, DAAM1, KIAA0666) (APC), D0875-01-APC-200ul
- Other applications not tested. Storage and stability may be stored at 4°c for short-term only. Applications suitable for use in flisa, western blot, and immunohistochemistry. Aliquots are stable for at least 6 months. Aliquot to avoid repeated freezing and thawing. Activation requires dvl-rho complex formation, an assembly mediated by daam1, which is thought to function as a scaffolding protein. Recommended dilution flisa 11,000 western blot 150-1100 immunohistochemistry 110-150 optimal dilutions to be determined by the researcher. Light sensitive. Recent evidence suggests a role for the formin homology (fh) proteins in these processes. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Daam1 contains fh domains and belongs to a novel fh protein subfamily implicated in cell polarity. Do not freeze apc conjugates. Wnt/fz signaling activates the small gtpase rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Note applications are based on unconjugated antibody. Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton.
DAAM2 (Disheveled-associated Activator Of Morphogenesis 2, KIAA0381) (FITC), 125617-FITC-100ul
- Daam2 is a 1068aa protein belonging to the formin homology family. Other applications not tested. Recommended dilution optimal dilutions to be determined by the researcher. It contains one of each dad (diaphanous autoregulatory), fh1 (formin homology 1), fh2 (formin homology 2) and gbd/fh3 (rho gtpase-binding/formin homology 3) domain. Its main function is actin cytoskeleton organization, thus leading to cell organization and biogenesis. Aa sequence maprkrshhglgflccfggsdipeinlrdnhplqfmefsspipnaeelnirfaelvdeldltdknreamfalppekkwqiycskkkvpsltplatsqgswhgvalaalacscihlmfitcqpcsrcwrnnse. It plays a role in rho gtpase binding and is expressed mostly in spinal cord and nerve tissues. Applications suitable for use in western blot.
DAAM1, CT (Disheveled-associated Activator Of Morphogenesis 1, DAAM1, KIAA0666) (AP), D0875-01A-AP-200ul
- Activation requires dvl-rho complex formation, an assembly mediated by daam1, which is thought to function as a scaffolding protein. Note applications are based on unconjugated antibody. Aliquots are stable for at least 6 months. Recommended dilution elisa 11,000 western blot 150-1100 immunohistochemistry 110-150 optimal dilutions to be determined by the researcher. Other applications not tested. Daam1 contains fh domains and belongs to a novel fh protein subfamily implicated in cell polarity. Applications suitable for use in elisa, western blot, and immunohistochemistry. Do not freeze alkaline phosphatase conjugates which could result in a substantial loss of enzymatic activity. Storage and stability may be stored at 4°c for short-term only. Wnt/fz signaling activates the small gtpase rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Light sensitive. Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the formin homology (fh) proteins in these processes. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
DAAM2, NT (Disheveled-associated Activator Of Morphogenesis 2, KIAA0381) (AP), D0875-02-AP-200ul
- For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Its main function is actin cytoskeleton organization, thus leading to cell organization and biogenesis. Note applications are based on unconjugated antibody. Aliquots are stable for at least 6 months. Applications suitable for use in elisa, western blot, and immunohistochemistry. Storage and stability may be stored at 4°c for short-term only. Daam2 is a 1068 amino acis protein belonging to the formin homology family. Other applications not tested. Light sensitive. Do not freeze alkaline phosphatase conjugates which could result in a substantial loss of enzymatic activity. It contains one of each dad (diaphanous autoregulatory), fh1 (formin homology 1), fh2 (formin homology 2) and gbd/fh3 (rho gtpase-binding/formin homology 3) domain. Recommended dilution elisa 11,000 western blot 150-1100 immunohistochemistry 110-150 optimal dilutions to be determined by the researcher. It plays a role in rho gtpase binding and is expressed mostly in spinal cord and nerve tissues.
DAAM1 (Disheveled-associated Activator Of Morphogenesis 1, KIAA0666) (HRP), 125616-HRP-100ul
- Other applications not tested. Daam1 contains fh domains and belongs to a novel fh protein subfamily implicated in cell polarity. Wnt/fz signaling activates the small gtpase rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton. Activation requires dvl-rho complex formation, an assembly mediated by daam1, which is thought to function as a scaffolding protein. Recent evidence suggests a role for the formin homology (fh) proteins in these processes. Applications suitable for use in elisa and western blot. Recommended dilution optimal dilutions to be determined by the researcher. Aa sequence maprkrggrgisfifccfrnndhpeityrlrndsnfalqtmepalpmppveeldvmfselvdeldltdkhreamfalpaekkwqiycskkkdqeenkgatswpefyidql.
DAAM1 (Disheveled-associated Activator Of Morphogenesis 1, KIAA0666), 125616-100ug
- For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Store at -20°c. Activation requires dvl-rho complex formation, an assembly mediated by daam1, which is thought to function as a scaffolding protein. Aliquot to avoid repeated freezing and thawing. Aa sequence maprkrggrgisfifccfrnndhpeityrlrndsnfalqtmepalpmppveeldvmfselvdeldltdkhreamfalpaekkwqiycskkkdqeenkgatswpefyidql storage and stability may be stored at 4°c for short-term only. Other applications not tested. Applications suitable for use in elisa and western blot. Recommended dilution optimal dilutions to be determined by the researcher. Daam1 contains fh domains and belongs to a novel fh protein subfamily implicated in cell polarity. Aliquots are stable for at least 12 months. Recent evidence suggests a role for the formin homology (fh) proteins in these processes. Wnt/fz signaling activates the small gtpase rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton.
FRMPD4, ID (FERM and PDZ Domain-containing Protein 4, PDZ Domain-containing Protein 10, PSD-95-interacting Regulator of Spine Morphogenesis, Preso, KIAA0316, PDZD10, PDZK10), F6076-34-50ug
- Required for the maintenance of excitatory synaptic transmission. Other applications not tested. Positive regulator of dendritic spine morphogenesis and density. Applications suitable for use in elisa, western blot and immunohistochemistry. Aliquots are stable for at least 12 months. Recommended dilution western blot 1-2ug/ml immunohistochemistry (formalin fixed paraffin embedded) 5ug/ml optimal dilutions to be determined by the researcher. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Storage and stability may be stored at 4°c for short-term only. Aliquot to avoid repeated freezing and thawing. Binds phosphatidylinositol-4,5-bisphosphate. Store at -20°c.
IFT74 (Intraflagellar Transport Protein 74 Homolog, Capillary Morphogenesis Gene 1 Protein, CMG-1, Coiled-coil Domain-containing Protein 2, CCDC2, CMG1) (AP), I8444-62A-AP-100ul
- 3-1ug/ml, observed in lysates of cell line hek293 on ~70-75kd bands immunohistochemistry (paraffin) 5-10ug/ml optimal dilutions to be determined by the researcher. Further dilutions can be made in assay buffer. Dilute only prior to immediate use. Recommended dilution immunofluorescence 2. Note applications are based on unconjugated antibody. 5mg/ml, on stain rat cortical neurons elisa 116,000 western blot 0. Applications suitable for use in immunofluorescence, elisa, western blot and immunohistochemistry. Other applications not tested. Storage and stability may be stored at 4°c before opening. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Freezing alkaline phosphatase conjugates will result in a substantial loss of activity. Stable for 12 months after receipt. Do not freeze stable at 4°c as an undiluted liquid.
ANTXR2 (Anthrax Toxin Receptor 2, Capillary Morphogenesis Gene 2 Protein, CMG-2, CMG2, FLJ31074, MGC111533, MGC45856), 123348-50ug
- Aa sequence mvaersparspgswlfpglwllvlsgpggllraqeqpscrrafdlyfvldksgsvannwieiynfvqqlaerfvspemrlsfivfssqatiilpltgdrgkiskgledlkrvspvgetyiheglklaneqiqkagglktssiiialtdgkldglvpsyaekeakisrslgasvycvgvldfeqaqleriadskeqvfpvkggfqalkgiinsilaqscteilelqpssvcvgeefqivlsgrgfmlgsrngsvlctytvnetyttsvkpvsvqlnsmlcpapilnkagetldvsvsfnggksvisgslivtatecsngiaaiivilvlllllgiglmwwfwplcckvvikdpppppapapkeeeeeplptkkwptvdasyyggrgvggikrmevrwgdkgsteegarlekaknavvkipeeteepirprpprpkpthqppqtkwytpikgrldalwallrrqydrvslmrpqegdegrcinfsrvpsq storage and stability may be stored at 4°c for short-term only. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Recommended dilution optimal dilutions to be determined by the researcher. Necessary for cellular interactions with laminin and the extracellular matrix. Store at -20°c. Applications suitable for use in western blot. Aliquot to avoid repeated freezing and thawing. Other applications not tested.
DAAM1, CT (Disheveled-associated Activator Of Morphogenesis 1, DAAM1, KIAA0666) (Azide free) (HRP), D0875-01A-HRP-200ul
- Aliquots are stable at -20°c for 12 months after receipt. Daam1 contains fh domains and belongs to a novel fh protein subfamily implicated in cell polarity. Storage and stability store product at 4°c if to be used immediately within two weeks. Recommended dilution elisa 11,000 western blot 150-1100 immunohistochemistry 110-150 optimal dilutions to be determined by the researcher. Note sodium azide is a potent inhibitor of peroxidase and should not be added to hrp conjugates. Further dilutions can be made in assay buffer. Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the formin homology (fh) proteins in these processes. Activation requires dvl-rho complex formation, an assembly mediated by daam1, which is thought to function as a scaffolding protein. Applications suitable for use in elisa, western blot, and immunohistochemistry. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note applications are based on unconjugated antibody. Dilute required amount only prior to immediate use. Wnt/fz signaling activates the small gtpase rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Other applications not tested. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°c.
DAAM2, NT (Disheveled-associated Activator Of Morphogenesis 2, KIAA0381) (Biotin), D0875-02-Biotin-200ul
- It plays a role in rho gtpase binding and is expressed mostly in spinal cord and nerve tissues. Aliquots are stable for at least 6 months. Its main function is actin cytoskeleton organization, thus leading to cell organization and biogenesis. Store at -20°c. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Aliquot to avoid repeated freezing and thawing. Daam2 is a 1068 amino acis protein belonging to the formin homology family. Storage and stability may be stored at 4°c for short-term only. Recommended dilution elisa 11,000 western blot 150-1100 immunohistochemistry 110-150 optimal dilutions to be determined by the researcher. Note applications are based on unconjugated antibody. It contains one of each dad (diaphanous autoregulatory), fh1 (formin homology 1), fh2 (formin homology 2) and gbd/fh3 (rho gtpase-binding/formin homology 3) domain. Other applications not tested. Applications suitable for use in elisa, western blot, and immunohistochemistry.
DAAM2, NT (Disheveled-associated Activator Of Morphogenesis 2, KIAA0381) (Azide free) (HRP), D0875-02-HRP-200ul
- It plays a role in rho gtpase binding and is expressed mostly in spinal cord and nerve tissues. Applications suitable for use in elisa, western blot, and immunohistochemistry. Further dilutions can be made in assay buffer. Note applications are based on unconjugated antibody. Other applications not tested. Note sodium azide is a potent inhibitor of peroxidase and should not be added to hrp conjugates. Its main function is actin cytoskeleton organization, thus leading to cell organization and biogenesis. Daam2 is a 1068 amino acis protein belonging to the formin homology family. Recommended dilution elisa 11,000 western blot 150-1100 immunohistochemistry 110-150 optimal dilutions to be determined by the researcher. Dilute required amount only prior to immediate use. Storage and stability store product at 4°c if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°c. Aliquots are stable at -20°c for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. It contains one of each dad (diaphanous autoregulatory), fh1 (formin homology 1), fh2 (formin homology 2) and gbd/fh3 (rho gtpase-binding/formin homology 3) domain.
DAAM1 (Disheveled-associated Activator Of Morphogenesis 1, KIAA0666) (FITC), 125616-FITC-100ul
- Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton. Daam1 contains fh domains and belongs to a novel fh protein subfamily implicated in cell polarity. Aa sequence maprkrggrgisfifccfrnndhpeityrlrndsnfalqtmepalpmppveeldvmfselvdeldltdkhreamfalpaekkwqiycskkkdqeenkgatswpefyidql. Recent evidence suggests a role for the formin homology (fh) proteins in these processes. Recommended dilution optimal dilutions to be determined by the researcher. Applications suitable for use in elisa and western blot. Wnt/fz signaling activates the small gtpase rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Other applications not tested. Activation requires dvl-rho complex formation, an assembly mediated by daam1, which is thought to function as a scaffolding protein.
DAAM1-T361, NT (DAAM1, KIAA0666, Disheveled-associated activator of morphogenesis 1) (FITC), 034453-FITC-200ul
- Evidence of alternative splicing has been observed for this gene but the full-length nature of these variants has not been determined. Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the formin homology (fh) proteins in these processes. Activation requires dvl-rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°c. Wnt/fz signaling activates the small gtpase rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Dilute required amount only prior to immediate use. Aliquots are stable at -20°c for 12 months after receipt. Note applications are based on unconjugated antibody. Applications suitable for use in western blot, immunohistochemistry, flow cytometry, flisa recommended dilution flisa 11,000 western blot 1100-500 immunohistochemistry 150-100 flow cytometry 110-50 storage and stability store product at 4°c if to be used immediately within two weeks. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Caution fitc conjugates are sensitive to light. The protein encoded by this gene contains fh domains and belongs to a novel fh protein subfamily implicated in cell polarity.
DAAM2 (Disheveled-associated Activator Of Morphogenesis 2, KIAA0381) (Biotin), 125617-Biotin-100ul
- Applications suitable for use in western blot. It plays a role in rho gtpase binding and is expressed mostly in spinal cord and nerve tissues. Recommended dilution optimal dilutions to be determined by the researcher. Other applications not tested. Its main function is actin cytoskeleton organization, thus leading to cell organization and biogenesis. Aa sequence maprkrshhglgflccfggsdipeinlrdnhplqfmefsspipnaeelnirfaelvdeldltdknreamfalppekkwqiycskkkvpsltplatsqgswhgvalaalacscihlmfitcqpcsrcwrnnse. Daam2 is a 1068aa protein belonging to the formin homology family. It contains one of each dad (diaphanous autoregulatory), fh1 (formin homology 1), fh2 (formin homology 2) and gbd/fh3 (rho gtpase-binding/formin homology 3) domain.
DAAM1, CT (Disheveled-associated Activator Of Morphogenesis 1, DAAM1, KIAA0666) (PE), D0875-01A-PE-200ul
- Activation requires dvl-rho complex formation, an assembly mediated by daam1, which is thought to function as a scaffolding protein. Stable for 12 months after receipt at 4°c. Wnt/fz signaling activates the small gtpase rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Freezing r-phycoerythrin (pe) conjugates will result in a substantial loss of activity. Recommended dilution flisa 11,000 western blot 150-1100 immunohistochemistry 110-150 optimal dilutions to be determined by the researcher. Other applications not tested. Dilute only prior to immediate use. Do not freeze stable at 4°c as an undiluted liquid. Storage and stability may be stored at 4°c before opening. Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the formin homology (fh) proteins in these processes. Note applications are based on unconjugated antibody. Applications suitable for use in flisa, western blot, and immunohistochemistry. Pe conjugates are sensitive to light. Daam1 contains fh domains and belongs to a novel fh protein subfamily implicated in cell polarity.
We are a participant in the Amazon Services LLC Associates Program, an affiliate advertising program designed to provide a means for us to earn fees by linking to Amazon.com and affiliated sites.
